Pfam domain
Pfam family: AAA_16 (PF13191.5)
Uniprot AC: Q9YEV6
RecName: ORC1-type DNA replication protein 1
Begin-End: 28-120
Organism: Aeropyrum pernix
Interaction Mode:  L-Bb 

Sequence:
VLPHREAELRRLAEVLAPALRGEKPSNALLYGLTGTGKTAVARLVLRRLEARASSLGVLV
KPIYVNARHRETPYRVASAIAEAVGVRVPFTGL
Structures of the domain Q9YEV6 28-120
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2v1u X-ray 3.1 A 33-115  L-Bb 


© NPIDB team 2003 - 2019

text