Pfam domain
Pfam family: Cdc6_C (PF09079.10)
Uniprot AC: Q9YEV6
RecName: ORC1-type DNA replication protein 1
Begin-End: 304-384
Organism: Aeropyrum pernix
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
LLSIMMLEDGGRPASTGEIYERYKELTSTLGLEHVTLRRVSGIISELDMLGIVKSRVVSR
GRYGKTREVSLDADRLAVENA
Structures of the domain Q9YEV6 304-384
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2v1u X-ray 3.1 A 308-388  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text