Pfam domain
Pfam family: MBD (PF01429.21)
Uniprot AC: Q9Z2D7
RecName: Methyl-CpG-binding domain protein 4
Begin-End: 71-135
Organism: Mus musculus
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
KPVPCGWERVVKQRLSGKTAGKFDVYFISPQGLKFRSKRSLANYLLKNGETFLKPEDFNF
TVLPK
Structures of the domain Q9Z2D7 71-135
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3vxv X-ray 2 A 71-135  H-Bb S-Bb S-Mj L-Bb L-Mj 
3vyb X-ray 2.4 A 72-134  H-Bb S-Bb S-Mj L-Bb L-Mj 
3vxx X-ray 2.2 A 72-134  H-Bb S-Bb S-Mj L-Bb L-Mj 
3vyq X-ray 2.52 A 70-132  H-Bb S-Bb S-Mj L-Bb L-Mj 
3vyq X-ray 2.52 D 70-132  S-Bb L-Bb 


© NPIDB team 2003 - 2021

text