Pfam domain
Pfam family: Arm-DNA-bind_3 (PF13356.5)
Uniprot AC: Q9Z3B4
RecName: CP4-like integrase
Begin-End: 3-78
Organism: Yersinia pestis
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb 

Sequence:
LTDAKIRTLKPSDKPFKVSDSHGLYLLVKPGGSRHWYLKYRISGKESRIALGAYPAISLS
DARQQREGIRKMLALN
Structures of the domain Q9Z3B4 3-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3rmp X-ray 2.21 A 3-76  H-Bb S-Bb S-Mj L-Bb 
3rmp X-ray 2.21 C 3-76  S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2019

text