Pfam domain
Pfam family: RNA_pol_L (PF01193.23)
Uniprot AC: Q9Z9H6
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 26-222
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
EPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKEL
VVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVD
RGVGYVPAEKHGIKDRINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSV
TPLEALNQAVEILREHL
Structures of the domain Q9Z9H6 26-222
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4q4z X-ray 2.9 B 26-222 None
4q4z X-ray 2.9 A 26-222 None
4q5s X-ray 3 B 26-222 None
4q5s X-ray 3 A 26-222 None


© NPIDB team 2003 - 2019

text