Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.25)
Uniprot AC: Q9Z9H6
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 52-180
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
AVTSVYIEDVLHEFSTIPGVKEDVVEIILNLKELVVRFLNPSLQTVTLLLKAEGPKEVKA
RDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKDRINAIPVDAVF
SPVRRVAFQ
Structures of the domain Q9Z9H6 52-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4q4z X-ray 2.9 B 59-154 None
4q4z X-ray 2.9 A 59-154 None
4q5s X-ray 3 B 59-154 None
4q5s X-ray 3 A 59-154 None


© NPIDB team 2003 - 2019

text