Pfam domain
Pfam family: FUR (PF01475.18)
Uniprot AC: V6F4Q0
RecName: Ferric uptake regulation protein
Begin-End: 11-130
Organism: Magnetospirillum gryphiswaldense MSR-1 v2
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
DKGMKMTDQRRVIAQVLSDSADHPDVEEVYRRATAKDPRISIATVYRTVRLFEEESILER
HDFGDGRARYEEAPSEHHDHLIDVNSARVIEFTSPEIEALQREIARKHGFRLVGHRLELY
Structures of the domain V6F4Q0 11-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4rb3 X-ray 2.6 D 12-130  H-Bb H-Mj L-Bb L-Mj L-Mn 
4rb3 X-ray 2.6 C 12-130  H-Bb H-Mj L-Bb L-Mj 
4rb2 X-ray 2.82 D 17-130  H-Bb H-Mj L-Bb 
4rb2 X-ray 2.82 C 17-130  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2020

text