Pfam domain
Pfam family: RNA_pol_Rpb2_7 (PF04560.19)
Uniprot AC: V9Z879
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 1058-1134
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
GGQRFGEMECWAMQAYGAAYTLQELLTIKSDDTVGRVKVYEAIVKGENIPEPGIPESFKV
LLKELQSLCLNVEVLSS
Structures of the domain V9Z879 1058-1134
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 C 1064-1138 None
6c04 X-ray 3.27 C 1064-1138 None


© NPIDB team 2003 - 2019

text