Pfam domain
Pfam family: RNA_pol_Rpb2_2 (PF04561.13)
Uniprot AC: V9Z879
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 175-373
Organism: Mycobacterium tuberculosis
Interaction Mode:  L-Bb 

Sequence:
RSPGVYFDETIDKSTDKTLHSVKVIPSRGAWLEFDVDKRDTVGVRIDRKRRQPVTVLLKA
LGWTSEQIVERFGFSEIMRSTLEKDNTVGTDEALLDIYRKLRPGEPPTKESAQTLLENLF
FKEKRYDLARVGRYKVNKKLGLHVGEPITSSTLTEEDVVATIEYLVRLHEGQTTMTVPGG
VEVPVETDDIDHFGNRRLR
Structures of the domain V9Z879 175-373
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 C 181-379 None
6c04 X-ray 3.27 C 181-379  L-Bb 


© NPIDB team 2003 - 2019

text