Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.15)
Uniprot AC: V9Z879
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 432-500
Organism: Mycobacterium tuberculosis
Interaction Mode:  L-Bb L-Mj L-Mn 

Sequence:
QFMDQNNPLSGLTHKRRLSALGPGGLSRERAGLEVRDVHPSHYGRMCPIETPEGPNIGLI
GSLSVYARV
Structures of the domain V9Z879 432-500
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 C 438-506 None
6c04 X-ray 3.27 C 438-506  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2019

text