Pfam domain
Pfam family: RNA_pol_Rpb2_45 (PF10385.8)
Uniprot AC: V9Z879
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 510-576
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
YRKVVDGVVSDEIVYLTADEEDRHVVAQANSPIDADGRFVEPRVLVRRKAGEVEYVPSSE
VDYMDVS
Structures of the domain V9Z879 510-576
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 C 516-582 None
6c04 X-ray 3.27 C 516-582 None


© NPIDB team 2003 - 2019

text