Pfam domain
Pfam family: RNA_pol_Rpb2_6 (PF00562.27)
Uniprot AC: V9Z879
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 637-1056
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
VAEESGVIEEVSADYITVMHDNGTRRTYRMRKFARSNHGTCANQCPIVDAGDRVEAGQVI
ADGPCTDDGEMALGKNLLVAIMPWEGHNYEDAIILSNRLVEEDVLTSIHIEEHEIDARDT
KLGAEEITRDIPNISDEVLADLDERGIVRIGAEVRDGDILVGKVTPKGETELTPEERLLR
AIFGEKAREVRDTSLKVPHGESGKVIGIRVFSREDEDELPAGVNELVRVYVAQKRKISDG
DKLAGRHGNKGVIGKILPVEDMPFLADGTPVDIILNTHGVPRRMNIGQILETHLGWCAHS
GWKVDAAKGVPDWAARLPDELLEAQPNAIVSTPVFDGAQEAELQGLLSCTLPNRDGDVLV
DADGKAMLFDGRSGEPFPYPVTVGYMYIMKLHHLVDDKIHARSTGPYSMITQQPLGGKAQ
Structures of the domain V9Z879 637-1056
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 C 643-1062 None
6c04 X-ray 3.27 C 643-1062 None


© NPIDB team 2003 - 2019

text