Pfam domain
Pfam family: Ribosomal_L34 (PF00468.16)
Uniprot AC: W5IDC1
RecName: Mitochondrial ribosomal protein L34
Begin-End: 53-95
Organism: Sus scrofa domesticus
Interaction Mode:   

Sequence:
GNEYQPSNIKRKHKHGWVRRLRTPTGVQVILRRMHKGRKSLSH
Structures of the domain W5IDC1 53-95
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 7 53-95 None


© NPIDB team 2003 - 2019

text