Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.20)
Uniprot AC: A0A063XB23
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 478-663
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
NILNPKDGKPVVTPSQDMVLGNYYLTLERAGAVGEGMVFKNTDEALLAYQNGYVHLHTRV
AVAANSLKNVTFTEEQRSKLLITTVGKLVFNEILPESFPYMNEPTKSNIEEKTPDRFFLE
KGADVKAVIAQQPINAPFKKGILGKIIAEIFKRFHITETSKMLDRMKNLGFKYSTKAGIT
VGVSDI
Structures of the domain A0A063XB23 478-663
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 D 478-663 None


© NPIDB team 2003 - 2021

text