Pfam domain
Pfam family: RNA_pol_Rpb1_4 (PF05000.19)
Uniprot AC: A0A063XB23
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 692-777
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
ITEEERYERVISIWSAAKDVIQGKLMKSLDELNPIYMMSDSGARGNASNFTQLAGMRGLM
ANPAGRIIELPIKSSFREGLTVLEYF
Structures of the domain A0A063XB23 692-777
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 D 692-777 None


© NPIDB team 2003 - 2021

text