Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: A0A063XB23
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 770-1131
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
GLTVLEYFISTHGARKGLADTALKTADSGYLTRRLVDVAQDVIIRETDCGTDRGILAKPL
KEGTETIERLEERLIGRFARKQVKHPETGEVLVNENELIDEDKALEIVEAGIEEVWIRSA
FTCNTPHGVCKRCYGRNLATGSDVEVGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDI
TQGLPRIQELFEARNPKGQATITEIDGTVVEINEVRDKQQEIVVQGAVETRSYTAPYNSR
LKVAEGDKITRGQVLTEGSIDPKELLKVTDLTTVQEYLLHEVQKVYRMQGVEIGDKHVEV
MVRQMLRKVRVIDAGDTDVLPGTLLDIHQFTEANKKVLLEGNRPATGRPVLLGITKASLE
TD
Structures of the domain A0A063XB23 770-1131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 D 770-1129  H-Bb 


© NPIDB team 2003 - 2021

text