Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: A0A063XI46
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-61
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
SLMNKLDSKYTLVTVSARRAREMQIKKDQMIEHTISHKYVGKALEEIDAGLLSF
Structures of the domain A0A063XI46 8-61
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wvj X-ray 3.36 F 8-61 None


© NPIDB team 2003 - 2021

text