Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: A0A071L394
RecName: 30S ribosomal protein S12
Begin-End: 12-118
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
RKRMVDKSDVPALQNCPQRRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVSSYIGGEG
HNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDTSGVKDRKQGRSKYG
Structures of the domain A0A071L394 12-118
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6spe X-ray 3.6 l 12-122 None
6spc X-ray 2.95 l 12-117 None


© NPIDB team 2003 - 2021

text