Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: A0A072Z681
RecName: TetR family transcriptional regulator
Begin-End: 24-70
Organism: Corynebacterium glutamicum ATCC 14067
Interaction Mode:   

Sequence:
ILDASAELFTHQGFATTSTHQIADAVGIRQASLYYHFPSKTEIFLTL
Structures of the domain A0A072Z681 24-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5dy0 X-ray 3 C 24-70  H-Bb H-Mj L-Bb L-Mj 
5dy0 X-ray 3 D 24-70  H-Bb H-Mj L-Bb L-Mj 
5dy0 X-ray 3 B 24-70  H-Bb H-Mj L-Bb L-Mj 
5dy0 X-ray 3 A 24-70  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text