Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A0A072ZDF7
RecName: 30S ribosomal protein S4
Begin-End: 96-143
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
CRLDNVVYRMGFGSTRSESRQLVSHKAITVNGQTVNIPSYQVKAGDVV
Structures of the domain A0A072ZDF7 96-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6spe X-ray 3.6 d 96-143 None
6spc X-ray 2.95 d 96-143 None


© NPIDB team 2003 - 2021

text