Pfam domain
Pfam family: RNA_pol_L (PF01193.26)
Uniprot AC: A0A073G207
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 29-228
Organism: Escherichia coli 2-427-07_S4_C3
Interaction Mode:   

Sequence:
EPLERGFGHTLGNALRRILLSSMPGCAVTEVEIDGVLHEYSTKEGVQEDILEILLNLKGL
AVRVQGKDEVILTLNKSGIGPVTAADITHDGDVEIVKPQHVICHLTDENASISMRIKVQR
GRGYVPASTRIHSEEDERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIEMETN
GTIDPEEAIRRAATILAEQL
Structures of the domain A0A073G207 29-228
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmu X-ray 3.18 A 29-228 None
6wmu X-ray 3.18 B 29-228 None


© NPIDB team 2003 - 2021

text