Pfam domain
Pfam family: Cas_Cas1 (PF01867.18)
Uniprot AC: A0A0F8IEL4
RecName: CRISPR-associated endonuclease Cas1
Begin-End: 11-295
Organism: Methanosarcina mazei
Interaction Mode:   

Sequence:
INMHVDGAKLHIKDGRFSTTEEPQEYVFSPKRIDIDGIIIYGKSGNLTLEAIRWLIKHNV
QVSILDWNGKLLTTMLPPESTNLRTKFAQYHAFEDKEARLEIAKKFIEAKFYKSKAVLDF
LSQRYPEINFDILDGLTKLKDVKSTREILGVEGTLAGKYWIEFSKAVPKEYDFCNRIDQF
RRAMGSGDMINTMLNYGYSLLEAECLKAINSVGLDTHVGFLHEMAPSKNSLAYDLQEPFR
FIVDLAVISLIESGAMESKDFIRTENYNLRLKPTGARKIVNEFSN
Structures of the domain A0A0F8IEL4 11-295
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6opm X-ray 3.1 D 16-294  H-Bb H-Mn L-Bb L-Mj 
6opm X-ray 3.1 C 16-294  H-Bb L-Bb 
6opm X-ray 3.1 A 16-294  H-Bb L-Bb 
6opm X-ray 3.1 B 16-294  H-Bb H-Mn L-Bb L-Mj 


© NPIDB team 2003 - 2021

text