Pfam domain
Pfam family: RE_AspBHI_N (PF18062.3)
Uniprot AC: A0A0J9X157
RecName: Restriction endonuclease
Begin-End: 58-253
Organism: Mycobacterium sp.
Interaction Mode:   

Sequence:
GLPKVMLEAGINAPAEVVGPDRSRRALIAIRSSPWKAGHETNPWHDEFDLDHGHVRYFGD
HKPSTVGLPGETKGNRLLLEAARLHAGTTREERLLAPPLFLFRAVTVHRAGRAVVKGHVE
FCGAAIIERLEHVVQRDPETGRSFPNLSLDLAVVSGGEIDGVDFRWIDDRRNAALAAGET
LRHAPESWIRWVRQGR
Structures of the domain A0A0J9X157 58-253
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r28 X-ray 3.06 C 58-253  S-Bb L-Bb L-Mj 
4r28 X-ray 3.06 D 58-253 None
4r28 X-ray 3.06 B 58-253 None
4r28 X-ray 3.06 A 58-253 None


© NPIDB team 2003 - 2021

text