Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A0A0J9X206
RecName: US4
Begin-End: 106-152
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
RRLQTQVYKLGLAKSVHHARVLITQRHIAVGKQIVNIPSFMVRLDSE
Structures of the domain A0A0J9X206 106-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 D 107-153 None


© NPIDB team 2003 - 2021

text