Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: A0A0J9X210
RecName: US8
Begin-End: 4-129
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
SVLADALNAINNAEKTGKRQVLIRPSSKVIIKFLQVMQKHGYIGEFEYIDDHRSGKIVVQ
LNGRLNKCGVISPRFNVKIGDIEKWTANLLPARQFGYVILTTSAGIMDHEEARRKHVSGK
ILGFVY
Structures of the domain A0A0J9X210 4-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 H 5-130 None


© NPIDB team 2003 - 2021

text