Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: A0A0J9X213
RecName: US10
Begin-End: 9-103
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
RITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKTPNGEGSKTWETY
EMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEVV
Structures of the domain A0A0J9X213 9-103
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 J 23-117 None


© NPIDB team 2003 - 2021

text