Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A0A0J9X225
RecName: 40S ribosomal protein S4
Begin-End: 41-89
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
LPLIVFLRNRLKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVI
Structures of the domain A0A0J9X225 41-89
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 W 42-90 None


© NPIDB team 2003 - 2021

text