Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: A0A0L7M7C8
RecName: 40S ribosomal protein S16
Begin-End: 12-143
Organism: Plasmodium falciparum (isolate Dd2)
Interaction Mode:   

Sequence:
GKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYILKTKVYEPLWLIGSGKLKNLDIRIRVK
GGGQTSQIYAIRQAIGKGIISYYQKYVDESTKKELKDVLLRYDRSLLVGDTRRCEPKKFG
GKGARARYQKSY
Structures of the domain A0A0L7M7C8 12-143
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6okk X-ray 3.3 M 12-143 None


© NPIDB team 2003 - 2021

text