Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: A0A0M3KL52
RecName: Mitochondrial ribosomal protein S12
Begin-End: 43-139
Organism: Sus scrofa
Interaction Mode:   

Sequence:
KHPPGKMGPTAGRPQLKGVVLRTFIRKPKKPNSANRKCCRVRLSTGREAVCFIPGEGHSL
QEHHVVLVQGGRTQDLPGVKLTVVRGKYDCGHVQKKK
Structures of the domain A0A0M3KL52 43-139
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aj3 X-ray 3.6 L 43-139 None


© NPIDB team 2003 - 2021

text