Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: A0A0M9AFS9
RecName: 30S ribosomal protein S8
Begin-End: 4-138
Organism: Thermus aquaticus
Interaction Mode:   

Sequence:
DPIADMLTRIRNATRVYKESTEVPASRFKEEILKILAREGFIKGYERVEVDGKPYLRIHL
KYGPRRQGPDPRPEQVIKHIRRISRPGRRVYVGVKEIPRVRRGLGIAILSTPKGVLTDRE
ARKLGVGGELICEVW
Structures of the domain A0A0M9AFS9 4-138
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4ox9 X-ray 3.8 H 4-138 None
4nxn X-ray 3.54 H 4-138 None
4gkj X-ray 3.3 H 4-138 None
4gkk X-ray 3.2 H 4-138 None
4lfa X-ray 3.65 H 4-138 None
4nxm X-ray 3.65 H 4-138 None
4khp X-ray 3.1 H 4-138 None
4lf6 X-ray 3.31 H 4-138 None
4lf4 X-ray 3.34 H 4-138 None
4lfc X-ray 3.6 H 4-138 None
4lf8 X-ray 3.15 H 4-138 None
4lf5 X-ray 3.75 H 4-138 None
4lfb X-ray 3.01 H 4-138 None
4lf9 X-ray 3.28 H 4-138 None
4lf7 X-ray 3.15 H 4-138 None


© NPIDB team 2003 - 2021

text