Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: A0A125YJX3
RecName: Ribosomal protein RPS15A
Begin-End: 106-231
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
NVLADCLKTLVNAEKRGRRQVLIRPSSKVIIKFLQCMQRRGYIGDFEIVDDHRAGKIVIE
LLGRINKCGVISPRFDIQVDKIEQFCSNLLPSRQFGHLVLTTAYGIMDHEEARRKHTGGK
ILGYFF
Structures of the domain A0A125YJX3 106-231
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 W 5-130 None


© NPIDB team 2003 - 2021

text