Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: A0A179R2V1
RecName: XRE family transcriptional regulator
Begin-End: 15-70
Organism: Pseudomonas putida
Interaction Mode:   

Sequence:
LREEFQKEMGFSAAALARALGVATPTVNNILRERGGVSADMALRLSICLDTTPEFW
Structures of the domain A0A179R2V1 15-70
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fix X-ray 3.8 E 15-70  H-Bb H-Mj L-Bb 
6fix X-ray 3.8 D 15-70  H-Bb H-Mj L-Bb L-Mj 
6fix X-ray 3.8 B 15-70  H-Bb H-Mj L-Bb L-Mj 
6fix X-ray 3.8 A 15-70  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text