Pfam domain
Pfam family: RAG1 (PF12940.9)
Uniprot AC: A0A185KID9
RecName: V(D)J recombination-activating protein 1
Begin-End: 545-1106
Organism: Branchiostoma belcheri
Interaction Mode:   

Sequence:
SCMTPEECLGMRLDMLMTKNQYSKEYNILKERGFSTLCPPKQLDAIEKTLMPGTARYSIE
GMDYSEHYFHSPVKMTGDLEVHSGETLEPDSVTMDFHEYVPDFPCPNTKGVRFPYAHAVA
KTLEELEDEIVNGLKKLGRDPNDPTLVIHTICKDGADGMGDVSVHKEKSDHLLPDKALRF
SFCVLRCSVMHKDTEVTIYEDPNPNSVRSNRPVLECIGDENDDGTVAVCVGPIECQRLLM
KDKIMRVHMSDGTQRAHYLTFFNSMVDEKWDRAHGGLAGAGSKYLCTLCEAVRDEALEKA
GSYKITRTLKKIEVTASKMKYESQEKDTFGVKGYPLLTTEPWERGIDATHTDINMGNYFK
SLIVREMAQVHSWAKTANVKKQIVDAESKLDKHLKESLGLNPTLMMAGNYARELFKAEHA
DKLVALVDKPDRKSALVEVLAKFRQLRKVYRANWPLNDMSDEVRQYKAKAVEMANDLKTH
FPYAPCTNYLHKVIEHVQELIEHPSGVGSVGALSSEGNEAGNKLFRQLRLGHARKGNTYN
GLRDVLCTHWLYTSKTLRDKAA
Structures of the domain A0A185KID9 545-1106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b40 X-ray 4.3 A 545-1109  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
6b40 X-ray 4.3 E 545-1109  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text