Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: A0A192B6J5
RecName: Anti-vesicular stomatitis virus N VHH (Fragment)
Begin-End: 7-122
Organism: Vicugna pacos
Interaction Mode:   

Sequence:
SGGGLVQAGGSLTLSCVASGRPFRNYRLGWFRQAPGKEREFVAAINWGGVITNYADSVKG
RFTISRDDAKNTVYLQMNSLKPEETAVYYCAAFDSTGSPIVRDNYEYWGQGTQVTV
Structures of the domain A0A192B6J5 7-122
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5ukb X-ray 5.47 e 8-125 None
5ukb X-ray 5.47 a 7-122 None
5ukb X-ray 5.47 b 8-125 None
5ukb X-ray 5.47 c 8-125 None
5ukb X-ray 5.47 d 7-122 None


© NPIDB team 2003 - 2021

text