Pfam domain
Pfam family: V-set (PF07686.19)
Uniprot AC: A0A192B6J6
RecName: Anti-vesicular stomatitis virus N VHH (Fragment)
Begin-End: 10-124
Organism: Vicugna pacos
Interaction Mode:   

Sequence:
GLVQTGGSLRLSCKASGRTFSNSIMGWFRQAPGKERDFVAKISWRNDYTTYADSVKGRFT
ISRDNASNMVYLLMNNLKPEDTAVYYCAATKAYNGGETSGRGFYYWGQGTQVTVS
Structures of the domain A0A192B6J6 10-124
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uk4 X-ray 3.2 q 10-124 None
5uk4 X-ray 3.2 l 11-125 None
5uk4 X-ray 3.2 r 10-124 None
5uk4 X-ray 3.2 m 10-124 None
5uk4 X-ray 3.2 o 11-126 None
5uk4 X-ray 3.2 k 10-124 None
5uk4 X-ray 3.2 t 10-124 None
5uk4 X-ray 3.2 s 11-125 None
5uk4 X-ray 3.2 n 11-128 None
5uk4 X-ray 3.2 p 10-124 None
5uk4 X-ray 3.2 e 11-133 None
5uk4 X-ray 3.2 a 11-130 None
5uk4 X-ray 3.2 i 10-124 None
5uk4 X-ray 3.2 j 10-124 None
5uk4 X-ray 3.2 g 10-124 None
5uk4 X-ray 3.2 h 11-125 None
5uk4 X-ray 3.2 d 11-128 None
5uk4 X-ray 3.2 c 11-127 None
5uk4 X-ray 3.2 b 10-124 None
5uk4 X-ray 3.2 f 11-125 None


© NPIDB team 2003 - 2021

text