Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: A0A1B4XKQ7
RecName: 30S ribosomal protein S12
Begin-End: 12-136
Organism: Enterococcus faecalis
Interaction Mode:   

Sequence:
RKSKVEKSDSPALNKGYNSFKKTQTNVNSPQKRGVCTRVGTMTPKKPNSALRKYARVRLS
NLIEVTAYIPGIGHNLQEHSVVLLRGGRVKDLPGVRYHIVRGALDTAGVNDRKQSRSKYG
TKRPK
Structures of the domain A0A1B4XKQ7 12-136
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wub X-ray 3.2 l 12-136 None


© NPIDB team 2003 - 2021

text