Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: A0A1B4XKS6
RecName: 30S ribosomal protein S8
Begin-End: 5-132
Organism: Enterococcus faecalis
Interaction Mode:   

Sequence:
DPIADFLTRIRNANMVKHETLEVPASKIKRDIAEILKREGFIRDVEYIEDDKQGVIRVFL
KYGKNEERVITNLKRISKPGLRAYVKADEVPKVLNGLGIAIISTSEGVITDKEARAKNIG
GEVIAYVW
Structures of the domain A0A1B4XKS6 5-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wub X-ray 3.2 h 5-132 None


© NPIDB team 2003 - 2021

text