Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A0A1B4XRV7
RecName: 30S ribosomal protein S4
Begin-End: 93-140
Organism: Enterococcus faecalis
Interaction Mode:   

Sequence:
QRLDNVVYRLGLATTRRQARQLVNHGHITVDGKRVDIPSYHVEVGQVI
Structures of the domain A0A1B4XRV7 93-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wub X-ray 3.2 d 93-140 None


© NPIDB team 2003 - 2021

text