Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: A0A1B4XSA2
RecName: 30S ribosomal protein S9
Begin-End: 10-130
Organism: Enterococcus faecalis
Interaction Mode:   

Sequence:
GRRKNAVARVRLVPGTGKITVNKKDVEEYIPHADLREVINQPFGVTETKGAYDVIVNVNG
GGYAGQSGAIRHGIARALLQVDPDFRSALKRAGLLTRDARMVERKKPGLKKARKASQFSK
R
Structures of the domain A0A1B4XSA2 10-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wua X-ray 3.2 i 10-130 None


© NPIDB team 2003 - 2021

text