Pfam domain
Pfam family: DNA_ligase_OB_2 (PF14743.8)
Uniprot AC: A0A1J0SCU0
RecName: DNA ligase
Begin-End: 245-310
Organism: Alteromonas mediterranea
Interaction Mode:  H-Bb S-Bb L-Bb L-Mn 

Sequence:
PGKGKFKGMMGSLLVETPAGVQFKLGTGFSEKERQAPPAIGSWVTFKFYGVTKNGKPRFA
SFLRVR
Structures of the domain A0A1J0SCU0 245-310
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gdr X-ray 2.33 A 225-290  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text