Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: A0A1J1EUF1
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-75
Organism: Thermus thermophilus
Interaction Mode:   

Sequence:
KLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKE
LLTGRLVF
Structures of the domain A0A1J1EUF1 8-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oy5 X-ray 3.1 E 8-75 None


© NPIDB team 2003 - 2021

text