Pfam domain
Pfam family: HTH_3 (PF01381.24)
Uniprot AC: A0A1L1QK15
RecName: Transcriptional regulator
Begin-End: 11-66
Organism: Streptococcus thermophilus
Interaction Mode:   

Sequence:
IKTERERQQMSREVLCLDGAELTVRQLIRIEKGESLPSLDRLSYIAKRLGKSMTEL
Structures of the domain A0A1L1QK15 11-66
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jub X-ray 2.57 B 11-66  H-Bb H-Mj L-Bb L-Mj 
5jub X-ray 2.57 A 11-66  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text