Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: A0A1L8G0X3
RecName: Histone H4
Begin-End: 32-102
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
KSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTIT
SREIQTAVRLL
Structures of the domain A0A1L8G0X3 32-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6g0l X-ray 10 H 29-97 None
6g0l X-ray 10 D 29-97 None
6kw5 X-ray 10.13 U 33-100  H-Bb S-Bb L-Bb 
6kw5 X-ray 10.13 Y 33-100  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text