Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: A0A1W2ITH4
RecName: Primosomal protein N'
Begin-End: 199-366
Organism: Klebsiella pneumoniae
Interaction Mode:   

Sequence:
NTEQATAVGAIHSAADRFSAWLLAGITGSGKTEVYLSVLENVLAQGRQALVMVPEIGLTP
QTIARFRQRFNAPVEVLHSGLNDSERLSAWLKAKNGEAAIVIGTRSSLFTPFKDLGVIVI
DEEHDSSYKQQEGWRYHARDLAVWRAHSEQIPIILGSATPALETLHNV
Structures of the domain A0A1W2ITH4 199-366
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dgd X-ray 2.82 A 199-366 None
6dgd X-ray 2.82 B 199-366 None


© NPIDB team 2003 - 2021

text