Pfam domain
Pfam family: GST_N (PF02798.22)
Uniprot AC: A0A1X3LEF3
RecName: Stringent starvation protein A
Begin-End: 10-81
Organism: Escherichia coli TA054
Interaction Mode:   

Sequence:
VMTLFSGPTDIYSHQVRIVLAEKGVSFEIEHVEKDNPPQDLIDLNPNQSVPTLVDRELTL
WESRIIMEYLDE
Structures of the domain A0A1X3LEF3 10-81
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmu X-ray 3.18 K 10-81 None
6wmu X-ray 3.18 L 9-81 None


© NPIDB team 2003 - 2021

text