Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: A0A218NZS6
RecName: 30S ribosomal protein S9
Begin-End: 8-132
Organism: Thermococcus celer Vu 13 = JCM 8558
Interaction Mode:   

Sequence:
GKRKTAIARATIREGKGRVRINHRPVEIIEPEIARFTIMEPLVLAGEEIVKGVDIDVKVE
GGGFMGQAEAARVAIARALVEWTNDMNLKEKFMKYDRTMLVGDSRRTEPHKPNRSTKGPR
AKRQK
Structures of the domain A0A218NZS6 8-132
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tmf X-ray 2.8 L 8-132 None


© NPIDB team 2003 - 2021

text