Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: A0A218NZT7
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Thermococcus celer Vu 13 = JCM 8558
Interaction Mode:   

Sequence:
DPLANALSHITNSERVGKKEVYLKPASKLMGEVLRVMQENGYIGEFEFIDDGRAGIYRVQ
LIGKINKAGAIKPRFPVKAREYEAWEKRFLPAFEFGILIVSTSQGVMTHKEAIEKGIGGR
LIAYVY
Structures of the domain A0A218NZT7 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tmf X-ray 2.8 J 5-130 None


© NPIDB team 2003 - 2021

text