Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: A0A218NZV3
RecName: 30S ribosomal protein S4
Begin-End: 103-152
Organism: Thermococcus celer Vu 13 = JCM 8558
Interaction Mode:   

Sequence:
RRLQTIVYKKGLARTPRQARQLIVHGHIEVNGQIIRSPGYLVLKAEEDTI
Structures of the domain A0A218NZV3 103-152
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tmf X-ray 2.8 E 103-152 None


© NPIDB team 2003 - 2021

text