Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: A0A218P3Q8
RecName: 30S ribosomal protein S10
Begin-End: 5-99
Organism: Thermococcus celer Vu 13 = JCM 8558
Interaction Mode:   

Sequence:
RIKLASTDIKALNEVTDQIRQIAERTGVRMSGPIPLPTKRIRITTRKSPDGEGTATFDKF
ELRVHKRLVDIEADERAMRQIMRIRVPEDVTIEIE
Structures of the domain A0A218P3Q8 5-99
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tmf X-ray 2.8 M 5-99 None


© NPIDB team 2003 - 2021

text