Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: A0A218P4I2
RecName: 30S ribosomal protein S12
Begin-End: 32-146
Organism: Thermococcus celer Vu 13 = JCM 8558
Interaction Mode:   

Sequence:
RRVLRLKEKSDPLEGAPQAKGIVLEKIAVEAKQPNSAMRKAVRVQLIKNGKVVTAFTPGD
GAINHIDEHDEVIIEGIGGPKGGSMGDIPGIRYKVVKVNRVSLKELVKGRKEKPR
Structures of the domain A0A218P4I2 32-146
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6tmf X-ray 2.8 O 32-146 None


© NPIDB team 2003 - 2021

text